PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr018924.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family GRAS
Protein Properties Length: 677aa    MW: 76990.5 Da    PI: 5.3765
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr018924.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS355.77e-1093076743374
         GRAS   3 elLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaNq 100
                  + L++cA+av+s d ++a++lL++++ ++sp+gd +qRla+y++ +L+ rl + +   y++lp s+ s    ++ l+a++++  ++P++k+s++ aN+
  Pbr018924.1 307 SMLTQCAQAVASYDRRNANELLQQIRLNSSPYGDGTQRLAHYLADGLELRLGS-GVPSYNSLPNSQMS---AADLLKAYQTYIRACPFHKMSNFYANK 400
                  689************************************************99.66777888888888...9************************** PP

         GRAS 101 aIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledleleeLrv 196
                  +Il+ +e+++r+HiiDf++ +G QWp+L++ L++R +gpp+lRiTgv+ p++g   +e++e+tg+rL++++++++v+fe+++ +ak++e++++e++++
  Pbr018924.1 401 TILKLAEKATRLHIIDFGVLYGYQWPCLIKGLSKRHGGPPMLRITGVEFPQPGfrPSERVEQTGRRLENYCKRFNVQFEYTA-IAKNWETIRYEDIKI 497
                  ****************************************************9*****************************.7************** PP

         GRAS 197 kpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgrei 294
                  + +E ++Vn+ ++l++l+de+v+    rd+vLkl+++++P+++++   + ++n++ F +rf eal ++s+lfd+++++lpre+++r  +Ere+ gr++
  Pbr018924.1 498 DGDELTVVNCLYRLKNLPDETVTDCP-RDTVLKLIREINPDIFIHGVVNGSYNAPFFDTRFKEALFHFSSLFDMFDETLPREDQHRLLYEREVYGRNA 594
                  ******************99998887.*********************************************************************** PP

         GRAS 295 vnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                   nv+aceg++r+er et+++W+ r ++aGF+++p ++++ k +++++++ + + + v+e+  ++++gWk+r + ++S W+
  Pbr018924.1 595 INVIACEGSRRVERPETYKQWQIRNKRAGFRQLPSDQEILKLVRSMVKRDYHKDFIVDEDGMWVLQGWKGRIVHAISYWK 674
                  *************************************************99888*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098562.264279654IPR005202Transcription factor GRAS
PfamPF035142.4E-106307674IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 677 aa     Download sequence    Send to blast
MDTFLDELPS PMKKFVFEQA PIPAYSNPNL VHEFEANHDF TDPSFFLVNP DPVSDSSSSP  60
GVSSEVDSPD SGDTSNEILR YISQMLMEEE EYLENKPCML HECLALQAAE KSLHDVLVQE  120
QNPFSTDPLV DSVYRYVESP NQGSNHSSSG SVAAGNWVGS DWDWVQDVSK SSPAQIPNPL  180
VSSGDGEIAH LEHNSSFVMA PRELLGKDVS FNSENGSRSK KNRQREDEDS VDDGRSNKLS  240
AVYADEIELP ELLDKVLLCE IDKQESNSCS PQESEKLQLN GKSRGSKGKK TRKKKPDDNA  300
GMVDLWSMLT QCAQAVASYD RRNANELLQQ IRLNSSPYGD GTQRLAHYLA DGLELRLGSG  360
VPSYNSLPNS QMSAADLLKA YQTYIRACPF HKMSNFYANK TILKLAEKAT RLHIIDFGVL  420
YGYQWPCLIK GLSKRHGGPP MLRITGVEFP QPGFRPSERV EQTGRRLENY CKRFNVQFEY  480
TAIAKNWETI RYEDIKIDGD ELTVVNCLYR LKNLPDETVT DCPRDTVLKL IREINPDIFI  540
HGVVNGSYNA PFFDTRFKEA LFHFSSLFDM FDETLPREDQ HRLLYEREVY GRNAINVIAC  600
EGSRRVERPE TYKQWQIRNK RAGFRQLPSD QEILKLVRSM VKRDYHKDFI VDEDGMWVLQ  660
GWKGRIVHAI SYWKPV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A3e-463096748375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009375910.10.0PREDICTED: scarecrow-like protein 11
TrEMBLM5W3910.0M5W391_PRUPE; Uncharacterized protein
STRINGPOPTR_0009s03850.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF13134339
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G59450.11e-174GRAS family protein